PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008704-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 216aa    MW: 24618.1 Da    PI: 8.0595
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008704-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32142200159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  NNU_008704-RA 142 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHS 200
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-34127200IPR003657WRKY domain
SuperFamilySSF1182901.57E-28134200IPR003657WRKY domain
PROSITE profilePS5081128.897137199IPR003657WRKY domain
SMARTSM007747.5E-38142201IPR003657WRKY domain
PfamPF031063.2E-25143199IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEGDRGAPRS CYELEVPFST TPQPIQEMGG FMQFEESQGL SFLVPSQSSQ LSLPLNHNNN  60
GSSNSVGLNG NEVATRPLWN DTQVGKLDAK TINEENSSGN VNDGNNNSWW RNSSSDKNKV  120
KARRKLREPR FCFQTRSDVD VLDDGYKWRK YGQKVVKNSL HPRSYYRCTH NNCRVKKRVE  180
RLSEDCRMVI TTYEGRHTHS PCDDSNSAEH ECFGSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25133199874Probable WRKY transcription factor 4
2lex_A2e-25133199874Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258736.11e-162PREDICTED: probable WRKY transcription factor 12 isoform X1
SwissprotQ93WY48e-71WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0S3SVH61e-105A0A0S3SVH6_PHAAN; Uncharacterized protein
STRINGGLYMA07G13611.11e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-61WRKY family protein